All products
Semaglutide
$85.00 - $245.00
Semaglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist studied in preclinical research models. Lyophilized white powder, ≥98% purity by HPLC, sealed under nitrogen. Supplied for laboratory research use only — not intended for human or veterinary consumption.
For research use only — not for human or veterinary consumption.
Technical Specifications
- Formula
- C187H291N45O59
- Molecular Weight
- 4113.58 g/mol
- Sequence
- HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (modified)
- Purity Target
- ≥98% by HPLC
- Appearance
- White lyophilized powder
- Vial Size
- 3 mg / 5 mg / 10 mg (see Strength variant)
- Concentration
- 2 mg/mL after reconstitution of a 5 mg vial with 2.5 mL bacteriostatic water
- Solubility
- Bacteriostatic water, sterile water for injection
- Storage
- Lyophilized: store at −20°C, protected from light. Reconstituted: 2–8°C, use within 28 days.
- Handling
- Open in a clean lab environment. Reconstitute slowly down the vial wall. Do not vortex.
